Project name: 1n0d

Status: done

submitted: 2025-12-12 14:05:28, status changed: 2025-12-12 15:32:52

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence CVWEGNKLHC
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.5615 5.00573 18.2562 168
cluster_2.pdb ( medoid) 30.5621 3.63195 19.233 111
cluster_3.pdb ( medoid) 25.0642 4.34884 28.9531 109
cluster_4.pdb ( medoid) 21.5373 9.7505 30.8472 210
cluster_5.pdb ( medoid) 11.0584 9.40463 19.1334 104
cluster_6.pdb ( medoid) 10.4195 12.1887 31.3358 127
cluster_7.pdb ( medoid) 9.7727 6.3442 15.7559 62
cluster_8.pdb ( medoid) 5.99416 6.17268 12.4194 37
cluster_9.pdb ( medoid) 4.63549 9.27625 17.6438 43
cluster_10.pdb ( medoid) 2.71645 10.6757 31.1354 29