Project name: 79a7c1bbd0e9d7c

Status: done

submitted: 2025-11-13 02:15:01, status changed: 2025-11-13 05:29:25

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence IGASWPDHATT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.2909 4.86341 26.5987 123
cluster_2.pdb ( medoid) 16.6301 7.03546 26.6182 117
cluster_3.pdb ( medoid) 13.1793 9.40866 37.5853 124
cluster_4.pdb ( medoid) 11.2455 13.1608 40.8892 148
cluster_5.pdb ( medoid) 11.0385 11.777 27.0737 130
cluster_6.pdb ( medoid) 8.46511 9.2143 21.139 78
cluster_7.pdb ( medoid) 7.98282 10.3973 28.4568 83
cluster_8.pdb ( medoid) 7.53389 10.3532 22.7692 78
cluster_9.pdb ( medoid) 5.56477 10.243 24.8236 57
cluster_10.pdb ( medoid) 3.85201 16.0955 32.787 62