CABS-dock: 79a7c1bbd0e9d7c

Project name: 79a7c1bbd0e9d7c

Status: done

submitted: 2025-11-13 02:15:01, status changed: 2025-11-13 05:29:25

Project settings

Protein sequence(s)	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence	IGASWPDHATT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.2909	4.86341	26.5987	123
cluster_2.pdb ( medoid)	16.6301	7.03546	26.6182	117
cluster_3.pdb ( medoid)	13.1793	9.40866	37.5853	124
cluster_4.pdb ( medoid)	11.2455	13.1608	40.8892	148
cluster_5.pdb ( medoid)	11.0385	11.777	27.0737	130
cluster_6.pdb ( medoid)	8.46511	9.2143	21.139	78
cluster_7.pdb ( medoid)	7.98282	10.3973	28.4568	83
cluster_8.pdb ( medoid)	7.53389	10.3532	22.7692	78
cluster_9.pdb ( medoid)	5.56477	10.243	24.8236	57
cluster_10.pdb ( medoid)	3.85201	16.0955	32.787	62