Project name: 79bfa4650ebc7ad

Status: done

submitted: 2025-05-19 16:40:56, status changed: 2025-05-20 00:32:14

Project settings
Protein sequence(s) GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTAFFAQLQLDEETGEFL input pdb
Peptide sequence WYDNEFG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.9639 4.56766 25.0593 146
cluster_2.pdb ( medoid) 24.0017 5.37462 36.7919 129
cluster_3.pdb ( medoid) 21.0098 6.85396 38.9592 144
cluster_4.pdb ( medoid) 14.4079 8.05114 27.4718 116
cluster_5.pdb ( medoid) 14.2562 9.39943 37.6006 134
cluster_6.pdb ( medoid) 5.91583 13.523 41.0248 80
cluster_7.pdb ( medoid) 5.49738 12.7333 36.2839 70
cluster_8.pdb ( medoid) 5.46068 13.0021 38.0301 71
cluster_9.pdb ( medoid) 4.9336 12.3642 30.5248 61
cluster_10.pdb ( medoid) 3.42149 14.3213 30.9855 49