Project name: 79f2ca4cb010cdd

Status: done

submitted: 2026-02-26 17:21:40, status changed: 2026-02-27 00:38:19

Project settings
Protein sequence(s) MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK input pdb
Peptide sequence EKWLALWLKE
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.1727 4.23765 11.3469 166
cluster_2.pdb ( medoid) 29.2921 4.95015 13.5337 145
cluster_3.pdb ( medoid) 21.6075 6.89575 42.1554 149
cluster_4.pdb ( medoid) 18.4039 6.30302 32.3842 116
cluster_5.pdb ( medoid) 15.1429 7.5283 20.6417 114
cluster_6.pdb ( medoid) 8.61682 8.2397 21.8552 71
cluster_7.pdb ( medoid) 8.59918 10.5824 39.2559 91
cluster_8.pdb ( medoid) 6.53941 13.4569 27.4797 88
cluster_9.pdb ( medoid) 3.08764 8.42068 15.8983 26
cluster_10.pdb ( medoid) 2.87088 11.8431 27.3404 34