Project name: 1073

Status: done

submitted: 2026-04-20 16:43:00, status changed: 2026-04-20 22:53:45

Project settings
Protein sequence(s) MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence RRKKAAVALLLAILLAL
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 65.0242 1.56865 37.4197 102
cluster_2.pdb ( medoid) 60.8913 1.05105 1.64197 64
cluster_3.pdb ( medoid) 17.7256 11.5652 52.8072 205
cluster_4.pdb ( medoid) 12.352 13.1963 41.73 163
cluster_5.pdb ( medoid) 10.3291 12.973 37.5244 134
cluster_6.pdb ( medoid) 7.5623 12.6946 32.615 96
cluster_7.pdb ( medoid) 5.85815 14.6804 37.5812 86
cluster_8.pdb ( medoid) 5.81977 15.6364 36.8864 91
cluster_9.pdb ( medoid) 1.8348 22.3457 43.1165 41
cluster_10.pdb ( medoid) 0.558612 16.1114 22.9656 9