CABS-dock: 7a54fe188045a85

Project name: 7a54fe188045a85

Status: done

submitted: 2026-06-02 11:55:51, status changed: 2026-06-02 16:33:18

Project settings

Protein sequence(s)	WSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFN input pdb
Peptide sequence	NVKEDKFKWNLTTRSHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	64.8101	1.63555	14.8122	106
cluster_2.pdb ( medoid)	26.4836	4.00248	19.1712	106
cluster_3.pdb ( medoid)	17.6401	9.58046	34.5224	169
cluster_4.pdb ( medoid)	14.3654	7.44845	25.683	107
cluster_5.pdb ( medoid)	13.0403	6.2882	18.8712	82
cluster_6.pdb ( medoid)	12.4899	11.3692	31.0501	142
cluster_7.pdb ( medoid)	11.7098	12.8952	39.4751	151
cluster_8.pdb ( medoid)	11.31	3.97879	13.8515	45
cluster_9.pdb ( medoid)	4.0341	10.907	21.0828	44
cluster_10.pdb ( medoid)	3.12574	15.3564	28.5279	48