CABS-dock: 7ad7c08f85d62c1

Project name: 7ad7c08f85d62c1

Status: done

submitted: 2025-05-10 03:21:26, status changed: 2025-05-10 09:12:08

Project settings

Protein sequence(s)	AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY input pdb
Peptide sequence	KLPGWSG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	67.7794	1.54914	13.3904	105
cluster_2.pdb ( medoid)	20.012	4.09754	15.2125	82
cluster_3.pdb ( medoid)	16.8945	6.39263	25.1478	108
cluster_4.pdb ( medoid)	16.784	5.24309	23.7905	88
cluster_5.pdb ( medoid)	15.8328	8.9687	42.4788	142
cluster_6.pdb ( medoid)	14.3419	11.4351	41.6541	164
cluster_7.pdb ( medoid)	11.2961	11.0657	29.3451	125
cluster_8.pdb ( medoid)	5.10781	18.2074	39.5721	93
cluster_9.pdb ( medoid)	4.2328	11.5763	25.4821	49
cluster_10.pdb ( medoid)	3.51566	12.5154	27.634	44