Project name: 7ad7c08f85d62c1

Status: done

submitted: 2025-05-10 03:21:26, status changed: 2025-05-10 09:12:08

Project settings
Protein sequence(s) AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY input pdb
Peptide sequence KLPGWSG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 67.7794 1.54914 13.3904 105
cluster_2.pdb ( medoid) 20.012 4.09754 15.2125 82
cluster_3.pdb ( medoid) 16.8945 6.39263 25.1478 108
cluster_4.pdb ( medoid) 16.784 5.24309 23.7905 88
cluster_5.pdb ( medoid) 15.8328 8.9687 42.4788 142
cluster_6.pdb ( medoid) 14.3419 11.4351 41.6541 164
cluster_7.pdb ( medoid) 11.2961 11.0657 29.3451 125
cluster_8.pdb ( medoid) 5.10781 18.2074 39.5721 93
cluster_9.pdb ( medoid) 4.2328 11.5763 25.4821 49
cluster_10.pdb ( medoid) 3.51566 12.5154 27.634 44