CABS-dock: 7b163e0c0ed6842

Project name: 7b163e0c0ed6842

Status: done

submitted: 2025-11-12 10:40:05, status changed: 2025-11-12 14:39:25

Project settings

Protein sequence(s)	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence	KVGTAAAISGAGKVT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.3853	7.93774	37.6911	138
cluster_2.pdb ( medoid)	16.7565	5.90816	24.6679	99
cluster_3.pdb ( medoid)	15.6336	7.41993	19.7531	116
cluster_4.pdb ( medoid)	14.8601	11.3054	36.0584	168
cluster_5.pdb ( medoid)	14.4054	10.2045	31.1592	147
cluster_6.pdb ( medoid)	8.34343	10.5472	31.4237	88
cluster_7.pdb ( medoid)	6.98052	12.6065	30.2881	88
cluster_8.pdb ( medoid)	6.26806	4.30756	16.9348	27
cluster_9.pdb ( medoid)	4.68207	16.2321	39.3588	76
cluster_10.pdb ( medoid)	4.23556	12.5131	26.5378	53