Project name: 7b163e0c0ed6842

Status: done

submitted: 2025-11-12 10:40:05, status changed: 2025-11-12 14:39:25

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence KVGTAAAISGAGKVT
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 17.3853 7.93774 37.6911 138
cluster_2.pdb ( medoid) 16.7565 5.90816 24.6679 99
cluster_3.pdb ( medoid) 15.6336 7.41993 19.7531 116
cluster_4.pdb ( medoid) 14.8601 11.3054 36.0584 168
cluster_5.pdb ( medoid) 14.4054 10.2045 31.1592 147
cluster_6.pdb ( medoid) 8.34343 10.5472 31.4237 88
cluster_7.pdb ( medoid) 6.98052 12.6065 30.2881 88
cluster_8.pdb ( medoid) 6.26806 4.30756 16.9348 27
cluster_9.pdb ( medoid) 4.68207 16.2321 39.3588 76
cluster_10.pdb ( medoid) 4.23556 12.5131 26.5378 53