Project name: 7b9bb9fe4aa29f

Status: done

submitted: 2026-07-29 04:55:10, status changed: 2026-07-29 06:40:47

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQVFGDSNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.0033 4.27538 27.0651 124
cluster_2.pdb ( medoid) 22.3728 9.65458 19.8905 216
cluster_3.pdb ( medoid) 19.1977 4.58388 40.6284 88
cluster_4.pdb ( medoid) 8.56348 12.2614 40.8341 105
cluster_5.pdb ( medoid) 7.33369 10.4995 31.6755 77
cluster_6.pdb ( medoid) 6.87286 15.8595 40.5185 109
cluster_7.pdb ( medoid) 6.55021 14.0454 31.7502 92
cluster_8.pdb ( medoid) 5.73471 13.9501 34.8547 80
cluster_9.pdb ( medoid) 5.34872 10.8437 32.2371 58
cluster_10.pdb ( medoid) 3.45602 14.7569 33.8703 51