CABS-dock: 7b9bb9fe4aa29f

Project name: 7b9bb9fe4aa29f

Status: done

submitted: 2026-07-29 04:55:10, status changed: 2026-07-29 06:40:47

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQVFGDSNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.0033	4.27538	27.0651	124
cluster_2.pdb ( medoid)	22.3728	9.65458	19.8905	216
cluster_3.pdb ( medoid)	19.1977	4.58388	40.6284	88
cluster_4.pdb ( medoid)	8.56348	12.2614	40.8341	105
cluster_5.pdb ( medoid)	7.33369	10.4995	31.6755	77
cluster_6.pdb ( medoid)	6.87286	15.8595	40.5185	109
cluster_7.pdb ( medoid)	6.55021	14.0454	31.7502	92
cluster_8.pdb ( medoid)	5.73471	13.9501	34.8547	80
cluster_9.pdb ( medoid)	5.34872	10.8437	32.2371	58
cluster_10.pdb ( medoid)	3.45602	14.7569	33.8703	51