CABS-dock: YWHAG_ABI3_D216

Project name: YWHAG_ABI3_D216_1433

Status: done

submitted: 2025-04-13 00:23:31, status changed: 2025-04-13 14:29:58

Project settings

Protein sequence(s)	MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN input pdb
Peptide sequence	SLASAGDAEGV
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.8095	4.27034	14.9486	170
cluster_2.pdb ( medoid)	32.9917	2.8492	9.37654	94
cluster_3.pdb ( medoid)	28.8017	4.79138	29.3606	138
cluster_4.pdb ( medoid)	26.9266	3.49097	9.3751	94
cluster_5.pdb ( medoid)	26.4114	3.71052	8.49804	98
cluster_6.pdb ( medoid)	19.4161	4.27481	7.85786	83
cluster_7.pdb ( medoid)	18.3212	8.56932	48.3303	157
cluster_8.pdb ( medoid)	11.479	6.62078	21.1836	76
cluster_9.pdb ( medoid)	3.6449	14.5409	46.4271	53
cluster_10.pdb ( medoid)	2.50057	14.7966	33.9233	37