Project name: YWHAG_ABI3_D216_1433

Status: done

submitted: 2025-04-13 00:23:31, status changed: 2025-04-13 14:29:58

Project settings
Protein sequence(s) MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN input pdb
Peptide sequence SLASAGDAEGV
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.8095 4.27034 14.9486 170
cluster_2.pdb ( medoid) 32.9917 2.8492 9.37654 94
cluster_3.pdb ( medoid) 28.8017 4.79138 29.3606 138
cluster_4.pdb ( medoid) 26.9266 3.49097 9.3751 94
cluster_5.pdb ( medoid) 26.4114 3.71052 8.49804 98
cluster_6.pdb ( medoid) 19.4161 4.27481 7.85786 83
cluster_7.pdb ( medoid) 18.3212 8.56932 48.3303 157
cluster_8.pdb ( medoid) 11.479 6.62078 21.1836 76
cluster_9.pdb ( medoid) 3.6449 14.5409 46.4271 53
cluster_10.pdb ( medoid) 2.50057 14.7966 33.9233 37