Project name: 7bf8de152ff53a9

Status: done

submitted: 2025-10-10 11:14:07, status changed: 2025-10-10 16:10:04

Project settings
Protein sequence(s) ASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRRYKLKYLDDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNNVNSIEDLKK input pdb
Peptide sequence ITSISLCTPGCKTGALMGCNMKTATCHCSI
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 17.0933 7.78083 35.9712 133
cluster_2.pdb ( medoid) 16.4357 5.9018 25.981 97
cluster_3.pdb ( medoid) 14.6905 7.28363 35.4408 107
cluster_4.pdb ( medoid) 11.8868 15.6476 47.4568 186
cluster_5.pdb ( medoid) 9.95121 9.94854 23.6824 99
cluster_6.pdb ( medoid) 8.06743 10.7841 38.8765 87
cluster_7.pdb ( medoid) 7.3994 9.59537 26.9213 71
cluster_8.pdb ( medoid) 6.3589 17.6131 40.3487 112
cluster_9.pdb ( medoid) 5.26556 11.2049 26.6642 59
cluster_10.pdb ( medoid) 3.88261 12.6204 31.1719 49