CABS-dock: 7c6b7a5329bc8ec

Project name: 7c6b7a5329bc8ec

Status: done

submitted: 2025-12-27 10:21:01, status changed: 2025-12-27 17:04:15

Project settings

Protein sequence(s)	RSVASSSKLWMLLEFSAFLEQQQDPDTYNKHLFVHIGLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNGSSFYGVSSQYEESSPENNMIITTCSTKVCSFGKQVVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSSVLENFTILQVVTTNRDTQETLLCIAYVVFEVSASEHGAQHHIYRLVKEDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPP input pdb
Peptide sequence	GLFDIIKKIAESF
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.5633	3.78107	20.3914	108
cluster_2.pdb ( medoid)	21.8399	3.02199	9.33127	66
cluster_3.pdb ( medoid)	20.8501	10.0239	26.0139	209
cluster_4.pdb ( medoid)	14.1584	3.95524	14.0353	56
cluster_5.pdb ( medoid)	13.6157	12.7794	32.9388	174
cluster_6.pdb ( medoid)	10.8056	7.95886	22.4397	86
cluster_7.pdb ( medoid)	10.0552	4.87308	14.0643	49
cluster_8.pdb ( medoid)	9.44236	9.42561	25.6354	89
cluster_9.pdb ( medoid)	8.29995	11.9278	27.5202	99
cluster_10.pdb ( medoid)	5.52925	11.5748	27.6098	64