CABS-dock: 7cb95372f10c990

Project name: 7cb95372f10c990

Status: done

submitted: 2025-12-31 15:53:59, status changed: 2025-12-31 18:41:38

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCEEEECCCCEEECCCCEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.4544	7.53206	24.6792	139
cluster_2.pdb ( medoid)	16.1987	11.7911	33.6196	191
cluster_3.pdb ( medoid)	15.8406	5.871	21.2136	93
cluster_4.pdb ( medoid)	15.7673	6.91302	29.8197	109
cluster_5.pdb ( medoid)	11.7583	10.5458	23.3708	124
cluster_6.pdb ( medoid)	10.7802	9.92563	25.6121	107
cluster_7.pdb ( medoid)	7.05334	13.7524	30.8793	97
cluster_8.pdb ( medoid)	5.71157	9.62957	26.3953	55
cluster_9.pdb ( medoid)	2.96733	17.1872	31.4578	51
cluster_10.pdb ( medoid)	2.50882	13.5522	25.0776	34