CABS-dock: 7cf33ea709e6adf

Project name: 7cf33ea709e6adf

Status: done

submitted: 2025-12-13 23:58:46, status changed: 2025-12-14 02:47:49

Project settings

Protein sequence(s)	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWFLNKDLEVDGHFVTMQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD input pdb
Peptide sequence	YLYNTGRSV
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	47.0276	2.14767	29.6702	101
cluster_2.pdb ( medoid)	45.9992	2.21743	31.1637	102
cluster_3.pdb ( medoid)	24.7681	8.07489	16.2376	200
cluster_4.pdb ( medoid)	20.2118	4.94761	9.45596	100
cluster_5.pdb ( medoid)	17.8623	6.15822	30.427	110
cluster_6.pdb ( medoid)	17.2376	5.80127	16.0826	100
cluster_7.pdb ( medoid)	7.5097	12.2508	33.699	92
cluster_8.pdb ( medoid)	6.20114	14.6747	35.8017	91
cluster_9.pdb ( medoid)	3.73014	13.9405	30.9063	52
cluster_10.pdb ( medoid)	3.2394	16.0524	33.2262	52