CABS-dock: 7d65536acfea2ab

Project name: 7d65536acfea2ab

Status: done

submitted: 2026-02-14 16:17:05, status changed: 2026-02-14 18:46:21

Project settings

Protein sequence(s)	AHGVYNAELSNKDPNILQQERAEVERYCKHNAQIRQSAIADKTVPPKVKLSSVKPAGGRHPAVLMCSAYRFYPHGIKVSWMRNGEVVKTDVTSTEEMPNGD input pdb
Peptide sequence	KLTSVDLSYAPRKKVTTVSNTNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCEEEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.2443	2.47307	26.8474	102
cluster_2.pdb ( medoid)	26.7987	4.142	17.6388	111
cluster_3.pdb ( medoid)	16.4005	9.87773	33.2632	162
cluster_4.pdb ( medoid)	10.4781	6.4897	21.6064	68
cluster_5.pdb ( medoid)	9.58287	17.74	45.9383	170
cluster_6.pdb ( medoid)	6.93777	13.549	32.236	94
cluster_7.pdb ( medoid)	6.67208	9.29245	22.0278	62
cluster_8.pdb ( medoid)	6.613	17.39	33.4166	115
cluster_9.pdb ( medoid)	5.45358	11.7354	26.2561	64
cluster_10.pdb ( medoid)	4.00509	12.9835	30.2617	52