Project name: 7dbfb6cd675a32

Status: done

submitted: 2025-05-19 20:03:38, status changed: 2025-05-19 21:12:28

Project settings
Protein sequence(s) GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALELVCGERGGFYTPK input pdb
Peptide sequence GPPGAP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 67.2976 1.23333 4.7519 83
cluster_2.pdb ( medoid) 52.4837 2.68655 12.9703 141
cluster_3.pdb ( medoid) 13.3266 8.32921 24.2742 111
cluster_4.pdb ( medoid) 11.4035 6.13844 15.256 70
cluster_5.pdb ( medoid) 10.3202 11.1432 32.4911 115
cluster_6.pdb ( medoid) 8.87696 9.688 24.7461 86
cluster_7.pdb ( medoid) 7.90962 9.86141 29.2816 78
cluster_8.pdb ( medoid) 7.5569 9.52772 24.0188 72
cluster_9.pdb ( medoid) 6.96196 14.0765 32.2779 98
cluster_10.pdb ( medoid) 5.61834 14.4171 34.7363 81