CABS-dock: 7e7b495b5f3c8be

Project name: 7e7b495b5f3c8be

Status: done

submitted: 2025-12-29 10:20:58, status changed: 2025-12-29 13:29:17

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEEEEECCCCCEECCCCEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.0957	2.51897	18.9955	101
cluster_2.pdb ( medoid)	19.7117	5.12386	20.1588	101
cluster_3.pdb ( medoid)	18.3751	6.63941	25.5663	122
cluster_4.pdb ( medoid)	17.5847	5.57304	23.5137	98
cluster_5.pdb ( medoid)	14.927	9.111	26.1776	136
cluster_6.pdb ( medoid)	11.2402	8.89664	24.6638	100
cluster_7.pdb ( medoid)	8.71451	8.14733	17.1755	71
cluster_8.pdb ( medoid)	8.04093	15.2967	29.2324	123
cluster_9.pdb ( medoid)	6.5876	15.0282	27.576	99
cluster_10.pdb ( medoid)	4.00104	12.2468	23.4244	49