Project name: IFLDSSPTTKAP

Status: done

submitted: 2026-04-02 08:15:53, status changed: 2026-04-02 08:49:43

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence IFLDSSPTTKAP
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.8099 5.92191 29.9534 141
cluster_2.pdb ( medoid) 20.5355 7.74268 21.6667 159
cluster_3.pdb ( medoid) 11.9402 7.45378 26.8697 89
cluster_4.pdb ( medoid) 10.9077 13.5684 34.8784 148
cluster_5.pdb ( medoid) 10.5675 11.3556 25.3446 120
cluster_6.pdb ( medoid) 9.74867 7.69336 24.3687 75
cluster_7.pdb ( medoid) 9.30983 4.29654 10.1196 40
cluster_8.pdb ( medoid) 8.41356 11.6479 41.9204 98
cluster_9.pdb ( medoid) 3.68234 17.9234 43.2824 66
cluster_10.pdb ( medoid) 3.57475 10.9099 22.6558 39