Project name: 7f15e066acd6af

Status: done

submitted: 2026-07-09 04:55:29, status changed: 2026-07-09 09:08:04

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence SADPFGGSHESKDNA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.1018 3.70696 21.5017 119
cluster_2.pdb ( medoid) 18.2857 6.67188 33.5042 122
cluster_3.pdb ( medoid) 16.6076 8.12882 25.185 135
cluster_4.pdb ( medoid) 13.9188 9.12436 30.1176 127
cluster_5.pdb ( medoid) 10.8345 7.0146 31.0227 76
cluster_6.pdb ( medoid) 9.15376 16.1682 35.7608 148
cluster_7.pdb ( medoid) 7.58167 13.1897 32.2217 100
cluster_8.pdb ( medoid) 6.06006 14.1913 37.7941 86
cluster_9.pdb ( medoid) 5.62704 12.2622 35.8552 69
cluster_10.pdb ( medoid) 2.31109 7.78853 15.7021 18