CABS-dock: 7f15e066acd6af

Project name: 7f15e066acd6af

Status: done

submitted: 2026-07-09 04:55:29, status changed: 2026-07-09 09:08:04

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	SADPFGGSHESKDNA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.1018	3.70696	21.5017	119
cluster_2.pdb ( medoid)	18.2857	6.67188	33.5042	122
cluster_3.pdb ( medoid)	16.6076	8.12882	25.185	135
cluster_4.pdb ( medoid)	13.9188	9.12436	30.1176	127
cluster_5.pdb ( medoid)	10.8345	7.0146	31.0227	76
cluster_6.pdb ( medoid)	9.15376	16.1682	35.7608	148
cluster_7.pdb ( medoid)	7.58167	13.1897	32.2217	100
cluster_8.pdb ( medoid)	6.06006	14.1913	37.7941	86
cluster_9.pdb ( medoid)	5.62704	12.2622	35.8552	69
cluster_10.pdb ( medoid)	2.31109	7.78853	15.7021	18