CABS-dock: RO33_USP7MATH[2]

Project name: RO33_USP7MATH[2]

Status: done

submitted: 2026-01-13 17:02:01, status changed: 2026-01-13 21:10:20

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW input pdb
Peptide sequence	PGAANPSDDSS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	55.267	2.08081	11.9597	115
cluster_2.pdb ( medoid)	21.4126	6.63162	18.4466	142
cluster_3.pdb ( medoid)	21.1544	4.91623	21.7762	104
cluster_4.pdb ( medoid)	20.7378	8.24582	21.3746	171
cluster_5.pdb ( medoid)	18.8659	4.98253	16.0925	94
cluster_6.pdb ( medoid)	15.6681	7.59504	28.0196	119
cluster_7.pdb ( medoid)	11.9827	7.84467	19.0899	94
cluster_8.pdb ( medoid)	6.8653	10.7788	24.5288	74
cluster_9.pdb ( medoid)	5.85597	11.6121	30.4619	68
cluster_10.pdb ( medoid)	1.14522	16.5906	25.1598	19