CABS-dock: 7f2b7653fdd26d0

Project name: 7f2b7653fdd26d0

Status: done

submitted: 2026-02-20 10:51:01, status changed: 2026-02-20 11:51:01

Project settings

Protein sequence(s)	GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH input pdb
Peptide sequence	CEGENSIPL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	42.9558	6.19241	34.7139	266
cluster_2.pdb ( medoid)	30.5777	3.63009	19.923	111
cluster_3.pdb ( medoid)	15.1515	5.41202	26.2516	82
cluster_4.pdb ( medoid)	14.1895	7.18839	21.5195	102
cluster_5.pdb ( medoid)	11.0682	5.78231	15.7302	64
cluster_6.pdb ( medoid)	9.92888	7.75516	23.389	77
cluster_7.pdb ( medoid)	6.64962	13.685	31.8323	91
cluster_8.pdb ( medoid)	5.52295	14.485	34.6466	80
cluster_9.pdb ( medoid)	4.93815	12.9603	33.2318	64
cluster_10.pdb ( medoid)	4.1929	15.0254	34.1293	63