CABS-dock: 7f37f6490d0de1

Project name: 7f37f6490d0de1

Status: done

submitted: 2026-06-12 06:35:10, status changed: 2026-06-12 10:43:32

Project settings

Protein sequence(s)	VPVYDTCTVPGSFALTFDDGPYGFSTRLDSTLNAANAKGSFFINGQNWGCIYDYADVLLERFNNGHFIASHTWSHVHMNQGTYEQLSHQLELVEQAMIRILGVKPLYMRPPYGEYNDVVLQVLRDRGYKGLIMWNQDSGDTFTPTPSSAQIIDSYRSFPEKTISLNHEIKDFTVDQVIPAVIPILQQKGFSLQTVPECLGLSSDPADWYVRVQEPGTRDDSWTCE input pdb
Peptide sequence	GPIQISHNYNYGPCGR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.9915	2.05803	16.8465	107
cluster_2.pdb ( medoid)	31.3178	4.78961	21.5486	150
cluster_3.pdb ( medoid)	26.233	6.97594	15.2966	183
cluster_4.pdb ( medoid)	21.5208	5.06487	21.364	109
cluster_5.pdb ( medoid)	20.6272	7.61132	40.4851	157
cluster_6.pdb ( medoid)	8.35238	7.42304	34.6951	62
cluster_7.pdb ( medoid)	7.45803	7.91093	14.2631	59
cluster_8.pdb ( medoid)	6.15612	12.6703	35.9032	78
cluster_9.pdb ( medoid)	5.46916	9.87354	19.3577	54
cluster_10.pdb ( medoid)	4.748	8.63522	16.6562	41