Project name: 1RV1-PGLPFHP

Status: done

submitted: 2025-08-25 08:34:10, status changed: 2025-08-25 13:12:15

Project settings
Protein sequence(s) ETLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVETLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVETLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV input pdb
Peptide sequence PGLPFHP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 70.5599 1.88492 18.2855 133
cluster_2.pdb ( medoid) 60.7757 1.66185 26.8256 101
cluster_3.pdb ( medoid) 40.6624 5.65634 30.8492 230
cluster_4.pdb ( medoid) 19.3904 2.83646 9.04131 55
cluster_5.pdb ( medoid) 17.3034 7.68635 44.3101 133
cluster_6.pdb ( medoid) 12.9378 10.4345 27.6696 135
cluster_7.pdb ( medoid) 11.3996 8.24591 39.117 94
cluster_8.pdb ( medoid) 6.81654 3.81425 29.2762 26
cluster_9.pdb ( medoid) 6.77364 9.0055 31.794 61
cluster_10.pdb ( medoid) 1.69174 18.9154 35.7187 32