CABS-dock: braf_monomer_peptide

Project name: braf_monomer_peptide_10

Status: done

submitted: 2025-12-28 10:32:04, status changed: 2025-12-28 17:36:10

Project settings

Protein sequence(s)	DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYKHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRRDLKSNNIFLHEDNNTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAEECLKKKRDERPSFPRILAEIEELARE input pdb
Peptide sequence	LRKTRHVNILLFMG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	42.0958	7.36415	43.3852	310
cluster_2.pdb ( medoid)	31.0171	3.96556	9.36112	123
cluster_3.pdb ( medoid)	21.2719	4.13692	11.8213	88
cluster_4.pdb ( medoid)	10.8537	10.7798	28.4828	117
cluster_5.pdb ( medoid)	9.40734	7.5473	16.7743	71
cluster_6.pdb ( medoid)	8.02992	9.83821	38.6942	79
cluster_7.pdb ( medoid)	7.42776	10.0973	34.927	75
cluster_8.pdb ( medoid)	6.67952	11.2284	26.875	75
cluster_9.pdb ( medoid)	3.5839	8.09174	25.8082	29
cluster_10.pdb ( medoid)	3.19184	10.3389	25.5015	33