Project name: 1JMM_PEP

Status: done

submitted: 2026-04-05 08:35:14, status changed: 2026-04-05 16:14:02

Project settings
Protein sequence(s) QKDLADYPVKLKAYEDEQASIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFLKASAVDDAFSKSTSKAKYVQKILQLDDLDITNLEQSNDVASSMELYGNFGDKAGWSTTVSNNSQVKWGSVLLERGQSATATYTNLQNSYYNGKKISKIVYKYTVDPKSKFQGQKVWLGIFTDPTLGVFASAYTGQVEKNTSIFIKNEFTFYDEDGKPINFDNALLSVASLNREHNSIEMAKDYSGKFVKISGSSIGEKNGMIYATDTLNFKQGEGGSRWTMYKNSQAGSGWDSSDAPNSWYGAGAIKMSGPNNHVTVGATSATNVMPVSDMPVVPGKDNTDGKKPNIWYSLNGKIRAVNVPKVTKEKPTPPV input pdb
Peptide sequence TQANFNTLRSLGVKGAVVKA
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHCCCCCEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 66.5275 1.50314 2.5221 100
cluster_2.pdb ( medoid) 24.0186 7.8689 20.3256 189
cluster_3.pdb ( medoid) 19.5458 3.73482 8.4621 73
cluster_4.pdb ( medoid) 16.9188 6.08791 18.5757 103
cluster_5.pdb ( medoid) 13.8615 7.79139 18.1116 108
cluster_6.pdb ( medoid) 11.73 15.1748 38.5184 178
cluster_7.pdb ( medoid) 8.56173 13.1983 43.1377 113
cluster_8.pdb ( medoid) 6.48551 4.16313 6.62595 27
cluster_9.pdb ( medoid) 4.2319 15.8321 40.3278 67
cluster_10.pdb ( medoid) 2.17172 18.4186 37.1945 40