CABS-dock: 7f8e263060a120

Project name: 7f8e263060a120

Status: done

submitted: 2025-12-23 09:09:55, status changed: 2025-12-23 11:13:31

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVIFVQCGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.5826	4.04114	25.3105	164
cluster_2.pdb ( medoid)	27.6524	3.32702	17.5185	92
cluster_3.pdb ( medoid)	20.926	5.06548	19.5961	106
cluster_4.pdb ( medoid)	19.7004	5.98973	27.1654	118
cluster_5.pdb ( medoid)	16.6176	6.5593	27.5092	109
cluster_6.pdb ( medoid)	16.4141	6.21417	34.4385	102
cluster_7.pdb ( medoid)	14.6062	4.24477	22.0072	62
cluster_8.pdb ( medoid)	7.93652	11.97	41.8046	95
cluster_9.pdb ( medoid)	6.65121	18.1922	43.6136	121
cluster_10.pdb ( medoid)	6.03858	5.13366	11.4393	31