Project name: M4DN3_UPPS

Status: done

submitted: 2026-06-10 06:00:17, status changed: 2026-06-10 09:39:23

Project settings
Protein sequence(s) KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence GPPG
Simulation mc cycles50
Peptide secondary structure psipred CCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 102.617 1.38378 4.66733 142
cluster_2.pdb ( medoid) 81.7785 2.18884 21.4317 179
cluster_3.pdb ( medoid) 27.4632 5.35262 33.2794 147
cluster_4.pdb ( medoid) 22.9045 6.76722 33.219 155
cluster_5.pdb ( medoid) 9.02682 5.09592 19.6641 46
cluster_6.pdb ( medoid) 7.84936 11.4659 36.4951 90
cluster_7.pdb ( medoid) 7.05652 10.9119 29.4493 77
cluster_8.pdb ( medoid) 6.80958 12.923 35.928 88
cluster_9.pdb ( medoid) 2.66394 14.2646 37.5414 38
cluster_10.pdb ( medoid) 2.39264 15.882 31.2278 38