Project name: Sukarna Basu

Status: done

submitted: 2025-12-13 01:46:45, status changed: 2025-12-13 07:32:08

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRVIVQVQCGSNSR
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.2632 3.5505 20.9799 111
cluster_2.pdb ( medoid) 22.6918 5.42046 35.5433 123
cluster_3.pdb ( medoid) 14.6917 6.60238 29.9851 97
cluster_4.pdb ( medoid) 14.1473 8.27015 32.0689 117
cluster_5.pdb ( medoid) 8.54083 14.8698 34.9965 127
cluster_6.pdb ( medoid) 7.93795 15.6212 46.6662 124
cluster_7.pdb ( medoid) 6.26149 18.2065 53.1786 114
cluster_8.pdb ( medoid) 5.47972 11.3145 30.5252 62
cluster_9.pdb ( medoid) 5.26962 13.853 45.0796 73
cluster_10.pdb ( medoid) 3.38193 15.3758 31.9862 52