CABS-dock: 7fda31ca0df825a

Project name: 7fda31ca0df825a

Status: done

submitted: 2025-02-04 18:40:14, status changed: 2025-02-05 01:07:01

Project settings

Protein sequence(s)	MTVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQSREAPF input pdb
Peptide sequence	GRNSL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.7447	5.66113	24.5694	225
cluster_2.pdb ( medoid)	23.2057	8.14455	26.6779	189
cluster_3.pdb ( medoid)	16.5158	5.81261	13.0274	96
cluster_4.pdb ( medoid)	15.398	10.4559	39.0865	161
cluster_5.pdb ( medoid)	15.1493	5.21476	36.3413	79
cluster_6.pdb ( medoid)	8.19261	8.78841	39.1608	72
cluster_7.pdb ( medoid)	7.39901	5.54128	11.2416	41
cluster_8.pdb ( medoid)	3.85123	10.6459	22.0266	41
cluster_9.pdb ( medoid)	3.35832	16.0795	35.1119	54
cluster_10.pdb ( medoid)	3.04612	13.788	48.1522	42