Project name: 800c43c973f2c75

Status: done

submitted: 2026-07-08 10:27:20, status changed: 2026-07-08 14:27:11

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQPYGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.8415 3.74526 22.4587 123
cluster_2.pdb ( medoid) 18.7095 6.84143 40.273 128
cluster_3.pdb ( medoid) 14.1872 9.09267 26.0585 129
cluster_4.pdb ( medoid) 9.85759 9.43436 37.7518 93
cluster_5.pdb ( medoid) 9.8195 11.2022 35.5709 110
cluster_6.pdb ( medoid) 9.49386 11.0598 28.0437 105
cluster_7.pdb ( medoid) 6.91206 13.5994 34.3422 94
cluster_8.pdb ( medoid) 6.63674 11.1501 24.0834 74
cluster_9.pdb ( medoid) 5.10802 17.4236 58.8378 89
cluster_10.pdb ( medoid) 3.07495 17.8865 48.6953 55