Project name: PEP2

Status: done

submitted: 2026-04-09 09:08:44, status changed: 2026-04-09 12:37:18

Project settings
Protein sequence(s) GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL input pdb
Peptide sequence VSEGKEKKGRLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.4561 4.47263 19.7676 172
cluster_2.pdb ( medoid) 38.326 2.71356 35.2716 104
cluster_3.pdb ( medoid) 24.5988 4.67503 31.9854 115
cluster_4.pdb ( medoid) 12.2196 14.4031 49.1631 176
cluster_5.pdb ( medoid) 11.2425 8.09431 28.0319 91
cluster_6.pdb ( medoid) 10.2729 6.81401 21.2946 70
cluster_7.pdb ( medoid) 9.413 9.87996 23.8696 93
cluster_8.pdb ( medoid) 6.59255 13.3484 42.1161 88
cluster_9.pdb ( medoid) 6.11974 9.31412 26.4648 57
cluster_10.pdb ( medoid) 5.70256 5.96223 10.1541 34