Project name: 80b99e18bcc1d94

Status: done

submitted: 2026-07-22 22:51:14, status changed: 2026-07-23 05:21:40

Project settings
Protein sequence(s) PPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCQGTTESDVV input pdb
Peptide sequence NVLKLASGE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.9302 6.01616 16.5088 156
cluster_2.pdb ( medoid) 21.5565 6.26261 19.0734 135
cluster_3.pdb ( medoid) 19.3481 7.23584 24.3217 140
cluster_4.pdb ( medoid) 13.8698 5.55164 15.288 77
cluster_5.pdb ( medoid) 12.3956 12.3431 39.6578 153
cluster_6.pdb ( medoid) 9.2362 8.22849 18.878 76
cluster_7.pdb ( medoid) 5.85572 8.88021 22.9397 52
cluster_8.pdb ( medoid) 5.71083 9.80593 27.7655 56
cluster_9.pdb ( medoid) 3.90783 9.21226 16.9104 36
cluster_10.pdb ( medoid) 1.72691 11.0023 19.2511 19