Project name: C-H-269_5

Status: done

submitted: 2025-02-04 08:29:45, status changed: 2025-02-04 22:39:16

Project settings
Protein sequence(s) MNMNVLVLCFVLSVSAEGLHVDRQVTGCSDHDGEQAYNLDGEELWFADFIKKEGVEPQPPFVDHMTYRDGTYQQAEANQQACKTSLDVLRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb
Peptide sequence TSEGCFKYFSKAYDV
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHHHCCC
Flexible regions
108:B - 18:B 100:A - 19:A
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.7803 5.38934 34.1495 209
cluster_2.pdb ( medoid) 21.7469 2.5291 5.78356 55
cluster_3.pdb ( medoid) 15.2284 3.34901 25.9854 51
cluster_4.pdb ( medoid) 14.7302 4.88791 9.78295 72
cluster_5.pdb ( medoid) 11.9616 13.1254 43.9131 157
cluster_6.pdb ( medoid) 11.5877 13.2899 35.7935 154
cluster_7.pdb ( medoid) 11.5103 4.86522 8.72299 56
cluster_8.pdb ( medoid) 6.20533 8.05759 31.0731 50
cluster_9.pdb ( medoid) 4.45036 17.7514 38.5548 79
cluster_10.pdb ( medoid) 1.91032 13.0868 30.5147 25