Project name: docking 2ai8 p4

Status: done

submitted: 2025-12-23 02:01:21, status changed: 2025-12-23 06:19:35

Project settings
Protein sequence(s) SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKA input pdb
Peptide sequence EVPNENLLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.1529 4.9018 30.8884 138
cluster_2.pdb ( medoid) 24.0863 6.1861 26.4118 149
cluster_3.pdb ( medoid) 23.3502 5.86719 19.909 137
cluster_4.pdb ( medoid) 14.87 4.77472 14.6812 71
cluster_5.pdb ( medoid) 14.0622 7.9646 41.4102 112
cluster_6.pdb ( medoid) 8.98202 10.688 34.9657 96
cluster_7.pdb ( medoid) 8.4971 14.2401 31.0474 121
cluster_8.pdb ( medoid) 7.13278 12.057 29.3147 86
cluster_9.pdb ( medoid) 5.03883 11.5106 32.5961 58
cluster_10.pdb ( medoid) 2.75963 11.5958 35.4143 32