CABS-dock: 9ASF_CEEASV

Project name: 9ASF_CEEASV_E2

Status: done

submitted: 2026-05-30 16:25:35, status changed: 2026-05-31 11:09:05

Project settings

Protein sequence(s)	GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence	CEEASVTVVEGQVDYYGLYYVHEGIR
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCEEEEEEEEEEEEEEEEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.3506	7.81765	32.0786	206
cluster_2.pdb ( medoid)	24.2418	4.12511	9.31018	100
cluster_3.pdb ( medoid)	21.0712	5.88481	23.8244	124
cluster_4.pdb ( medoid)	18.3876	8.7559	27.8788	161
cluster_5.pdb ( medoid)	7.8956	12.7919	32.4293	101
cluster_6.pdb ( medoid)	7.41846	10.3795	23.4709	77
cluster_7.pdb ( medoid)	7.09496	6.62442	23.4831	47
cluster_8.pdb ( medoid)	5.69085	14.5848	35.7999	83
cluster_9.pdb ( medoid)	5.4998	11.0913	25.0816	61
cluster_10.pdb ( medoid)	4.47383	8.94088	31.1461	40