CABS-dock: 820313e2664aec6

Project name: 820313e2664aec6

Status: done

submitted: 2026-06-17 08:42:03, status changed: 2026-06-17 10:22:28

Project settings

Protein sequence(s)	GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE input pdb
Peptide sequence	ARTKQTARKSTGGKAPRKQL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHCCCCCCHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.9366	9.31817	36.1886	251
cluster_2.pdb ( medoid)	20.2639	7.35297	23.2213	149
cluster_3.pdb ( medoid)	17.4014	6.78107	28.8388	118
cluster_4.pdb ( medoid)	12.6572	5.13541	19.7652	65
cluster_5.pdb ( medoid)	10.9137	6.04742	19.217	66
cluster_6.pdb ( medoid)	6.95962	11.2075	27.0087	78
cluster_7.pdb ( medoid)	6.40068	14.8422	34.3289	95
cluster_8.pdb ( medoid)	5.74651	15.4877	38.8288	89
cluster_9.pdb ( medoid)	4.38138	15.7485	32.5862	69
cluster_10.pdb ( medoid)	1.99871	10.0064	16.713	20