Project name: 82e9a968496163f

Status: done

submitted: 2026-01-20 05:55:28, status changed: 2026-01-20 09:09:20

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence RVIFVQVGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.707 5.01565 14.9345 149
cluster_2.pdb ( medoid) 20.4208 5.58254 28.9858 114
cluster_3.pdb ( medoid) 18.5796 5.97429 18.1721 111
cluster_4.pdb ( medoid) 16.6427 7.09018 23.9942 118
cluster_5.pdb ( medoid) 15.7568 10.9794 32.667 173
cluster_6.pdb ( medoid) 9.34693 8.87992 23.9989 83
cluster_7.pdb ( medoid) 6.48414 11.8751 35.2338 77
cluster_8.pdb ( medoid) 5.44057 17.2776 33.2196 94
cluster_9.pdb ( medoid) 5.15978 9.10892 25.3659 47
cluster_10.pdb ( medoid) 3.54918 9.57968 22.2618 34