Project name: 8441db7a0c09bd9

Status: done

submitted: 2026-06-17 06:48:30, status changed: 2026-06-17 14:09:41

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRVQPYGSNDARRHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCHHHHCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.6948 10.0026 32.3616 197
cluster_2.pdb ( medoid) 11.6074 9.5629 28.6864 111
cluster_3.pdb ( medoid) 10.359 11.1014 26.467 115
cluster_4.pdb ( medoid) 9.76209 12.9071 31.7964 126
cluster_5.pdb ( medoid) 7.12086 16.2902 43.7422 116
cluster_6.pdb ( medoid) 5.32454 11.2686 31.305 60
cluster_7.pdb ( medoid) 4.81076 18.0845 36.8879 87
cluster_8.pdb ( medoid) 4.71769 15.0498 36.2467 71
cluster_9.pdb ( medoid) 4.49043 14.4752 37.4706 65
cluster_10.pdb ( medoid) 2.99092 17.386 38.8594 52