CABS-dock: 8441db7a0c09bd9

Project name: 8441db7a0c09bd9

Status: done

submitted: 2026-06-17 06:48:30, status changed: 2026-06-17 14:09:41

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQPYGSNDARRHHHHHHHHHHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCHHHHCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.6948	10.0026	32.3616	197
cluster_2.pdb ( medoid)	11.6074	9.5629	28.6864	111
cluster_3.pdb ( medoid)	10.359	11.1014	26.467	115
cluster_4.pdb ( medoid)	9.76209	12.9071	31.7964	126
cluster_5.pdb ( medoid)	7.12086	16.2902	43.7422	116
cluster_6.pdb ( medoid)	5.32454	11.2686	31.305	60
cluster_7.pdb ( medoid)	4.81076	18.0845	36.8879	87
cluster_8.pdb ( medoid)	4.71769	15.0498	36.2467	71
cluster_9.pdb ( medoid)	4.49043	14.4752	37.4706	65
cluster_10.pdb ( medoid)	2.99092	17.386	38.8594	52