CABS-dock: 8458142ec0b0f5e

Project name: 8458142ec0b0f5e

Status: done

submitted: 2026-04-12 09:04:15, status changed: 2026-04-12 11:06:21

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRVQLFGSNDARRY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.0145	5.84577	32.0612	117
cluster_2.pdb ( medoid)	18.7068	7.91157	35.1994	148
cluster_3.pdb ( medoid)	18.4681	4.49423	21.9318	83
cluster_4.pdb ( medoid)	16.1297	13.2055	39.8425	213
cluster_5.pdb ( medoid)	14.3548	10.8675	36.7772	156
cluster_6.pdb ( medoid)	5.01461	8.17612	20.1582	41
cluster_7.pdb ( medoid)	4.7814	14.4309	29.9366	69
cluster_8.pdb ( medoid)	4.25886	15.4971	31.6236	66
cluster_9.pdb ( medoid)	3.6579	16.4029	33.7313	60
cluster_10.pdb ( medoid)	3.08884	15.216	29.0924	47