CABS-dock: 84702a0c6873167

Project name: 84702a0c6873167

Status: done

submitted: 2025-04-14 16:42:09, status changed: 2025-04-14 19:19:36

Project settings

Protein sequence(s)	EHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNPWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFL input pdb
Peptide sequence	EKKIVSIKNFLESEK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEECHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	68.6403	3.14684	8.14958	216
cluster_2.pdb ( medoid)	23.4724	6.00707	39.577	141
cluster_3.pdb ( medoid)	22.4662	6.23159	27.6371	140
cluster_4.pdb ( medoid)	15.465	7.04817	37.8515	109
cluster_5.pdb ( medoid)	15.3045	8.88629	29.5674	136
cluster_6.pdb ( medoid)	10.2793	7.39347	16.3752	76
cluster_7.pdb ( medoid)	8.83996	9.16294	32.6513	81
cluster_8.pdb ( medoid)	7.47815	6.68615	39.3759	50
cluster_9.pdb ( medoid)	3.45193	8.11141	19.1966	28
cluster_10.pdb ( medoid)	1.35921	16.9216	38.8578	23