CABS-dock: 2O2F-PGLPFHP

Project name: 2O2F-PGLPFHP

Status: done

submitted: 2025-08-25 08:42:05, status changed: 2025-08-25 10:51:35

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	PGLPFHP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.7532	8.6062	32.4551	170
cluster_2.pdb ( medoid)	17.6079	9.314	32.2862	164
cluster_3.pdb ( medoid)	14.873	8.87514	30.8907	132
cluster_4.pdb ( medoid)	13.6218	10.8649	28.6275	148
cluster_5.pdb ( medoid)	8.90904	8.64291	25.5902	77
cluster_6.pdb ( medoid)	5.73782	12.5483	27.4834	72
cluster_7.pdb ( medoid)	4.76207	12.5996	33.0437	60
cluster_8.pdb ( medoid)	4.7395	14.3475	32.111	68
cluster_9.pdb ( medoid)	3.72217	13.9704	31.3596	52
cluster_10.pdb ( medoid)	3.47734	16.3918	34.6723	57