CABS-dock: SMC-I- hMPV-F

Project name: SMC-I- hMPV-F

Status: done

submitted: 2025-06-21 17:47:21, status changed: 2025-06-21 20:12:18

Project settings

Protein sequence(s)	MPTSAGQIKLMLENRAMVRRKGFGILIGVYGSSVIYMVQLPIFGVIDTPCWIVKAAPSCSEKKGNYACLLREDQGWYCQNAGSTVYYPNEKDCETRGDHVFCDTAAGINVAEQSKECNINISTTNYPCKV input pdb
Peptide sequence	CLGVGSCNDFAGCGYAVVCFW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCCCCCCCEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.4658	5.24167	20.8602	123
cluster_2.pdb ( medoid)	17.8757	9.84575	35.1297	176
cluster_3.pdb ( medoid)	16.5108	10.1752	36.0407	168
cluster_4.pdb ( medoid)	15.3535	12.4402	31.3351	191
cluster_5.pdb ( medoid)	9.02286	7.75808	29.9929	70
cluster_6.pdb ( medoid)	8.37831	10.0259	34.074	84
cluster_7.pdb ( medoid)	5.63372	14.5552	40.9174	82
cluster_8.pdb ( medoid)	2.97862	16.7863	35.6995	50
cluster_9.pdb ( medoid)	2.52915	11.4663	27.2563	29
cluster_10.pdb ( medoid)	2.44214	11.0559	23.8191	27