CABS-dock: 84e3c31d9565d06

Project name: 84e3c31d9565d06

Status: done

submitted: 2025-06-20 19:49:34, status changed: 2025-06-21 03:48:40

Project settings

Protein sequence(s)	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEFLPSDFFPSVMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence	FLPSDFFPSV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.2002	2.61193	15.259	105
cluster_2.pdb ( medoid)	31.0239	4.02916	28.3628	125
cluster_3.pdb ( medoid)	25.55	6.34051	18.3719	162
cluster_4.pdb ( medoid)	24.7965	7.94467	27.9419	197
cluster_5.pdb ( medoid)	19.7371	5.97859	29.1564	118
cluster_6.pdb ( medoid)	14.9045	11.2718	38.7731	168
cluster_7.pdb ( medoid)	4.7583	11.7689	22.4103	56
cluster_8.pdb ( medoid)	4.10685	7.30486	18.6627	30
cluster_9.pdb ( medoid)	1.70266	13.5083	26.965	23
cluster_10.pdb ( medoid)	1.56513	10.2228	21.907	16