Project name: 84e3c31d9565d06

Status: done

submitted: 2025-06-20 19:49:34, status changed: 2025-06-21 03:48:40

Project settings
Protein sequence(s) GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEFLPSDFFPSVMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence FLPSDFFPSV
Simulation mc cycles50
Peptide secondary structure psipred CCCHHCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.2002 2.61193 15.259 105
cluster_2.pdb ( medoid) 31.0239 4.02916 28.3628 125
cluster_3.pdb ( medoid) 25.55 6.34051 18.3719 162
cluster_4.pdb ( medoid) 24.7965 7.94467 27.9419 197
cluster_5.pdb ( medoid) 19.7371 5.97859 29.1564 118
cluster_6.pdb ( medoid) 14.9045 11.2718 38.7731 168
cluster_7.pdb ( medoid) 4.7583 11.7689 22.4103 56
cluster_8.pdb ( medoid) 4.10685 7.30486 18.6627 30
cluster_9.pdb ( medoid) 1.70266 13.5083 26.965 23
cluster_10.pdb ( medoid) 1.56513 10.2228 21.907 16