CABS-dock: 251125 PD_CL2

Project name: 251125 PD_CL2_5

Status: done

submitted: 2025-11-25 02:11:37, status changed: 2025-11-25 06:48:22

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPEL input pdb
Peptide sequence	WHRSYYTWNLNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	136.567	0.490601	13.3474	67
cluster_2.pdb ( medoid)	25.7147	6.14433	20.0053	158
cluster_3.pdb ( medoid)	20.2214	10.5334	29.0672	213
cluster_4.pdb ( medoid)	19.1424	8.20169	28.6413	157
cluster_5.pdb ( medoid)	16.3072	9.50501	36.7542	155
cluster_6.pdb ( medoid)	9.72785	8.84059	20.8622	86
cluster_7.pdb ( medoid)	8.52429	3.63667	15.104	31
cluster_8.pdb ( medoid)	3.81713	13.8848	30.0305	53
cluster_9.pdb ( medoid)	3.66711	10.3624	19.6567	38
cluster_10.pdb ( medoid)	2.40251	17.4817	33.7389	42