CABS-dock: MM19-2183 no HA bidning selceted

Project name: MM19-2183 no HA bidning selceted

Status: done

submitted: 2025-05-20 10:33:11, status changed: 2025-05-20 14:38:39

Project settings

Protein sequence(s)

QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV input pdb

Peptide sequence

WDSRGKDSYETSQL

Simulation mc cycles

Peptide secondary structure psipred

CCCCCCCCCCCCCC

Flexible regions

158:A - 178:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.9434	5.03134	14.6421	206
cluster_2.pdb ( medoid)	28.743	2.29621	16.1323	66
cluster_3.pdb ( medoid)	20.2287	7.41521	22.4884	150
cluster_4.pdb ( medoid)	17.1488	7.93057	27.7472	136
cluster_5.pdb ( medoid)	14.8968	7.85401	26.5858	117
cluster_6.pdb ( medoid)	13.2543	5.65855	21.1387	75
cluster_7.pdb ( medoid)	12.6024	8.96653	24.2504	113
cluster_8.pdb ( medoid)	7.34015	11.4439	27.1369	84
cluster_9.pdb ( medoid)	2.90759	9.97389	22.4923	29
cluster_10.pdb ( medoid)	2.06447	11.6253	23.489	24