Project name: 8639449e1152fa6

Status: done

submitted: 2026-03-16 10:46:28, status changed: 2026-03-16 18:13:57

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RRRGGVQLFGRRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.0172 6.69425 30.7299 134
cluster_2.pdb ( medoid) 16.5979 7.89256 40.0847 131
cluster_3.pdb ( medoid) 14.8856 7.72557 37.763 115
cluster_4.pdb ( medoid) 14.193 9.30036 47.4338 132
cluster_5.pdb ( medoid) 13.9502 10.3941 39.737 145
cluster_6.pdb ( medoid) 8.33585 14.6356 33.0859 122
cluster_7.pdb ( medoid) 5.93718 15.1587 44.1892 90
cluster_8.pdb ( medoid) 3.10819 21.5559 52.0654 67
cluster_9.pdb ( medoid) 2.15715 14.8344 32.2133 32
cluster_10.pdb ( medoid) 1.61859 19.7703 38.0928 32