CABS-dock: 86fe2c7541576a6

Project name: 86fe2c7541576a6

Status: done

submitted: 2026-03-16 07:31:06, status changed: 2026-03-17 00:53:22

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRRRRHGGVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.2585	6.3532	37.5549	116
cluster_2.pdb ( medoid)	18.1286	6.45389	32.1873	117
cluster_3.pdb ( medoid)	13.5746	8.61901	39.0184	117
cluster_4.pdb ( medoid)	13.1721	11.0081	54.1504	145
cluster_5.pdb ( medoid)	8.35886	12.5615	26.2864	105
cluster_6.pdb ( medoid)	6.89617	16.9659	51.5422	117
cluster_7.pdb ( medoid)	5.2663	11.2033	45.6816	59
cluster_8.pdb ( medoid)	4.70423	19.5569	44.5909	92
cluster_9.pdb ( medoid)	4.0211	19.149	54.3065	77
cluster_10.pdb ( medoid)	3.5771	15.3756	34.3011	55