CABS-dock: 8TBP_HRDSVD

Project name: 8TBP_HRDSVD_E2

Status: done

submitted: 2026-05-30 16:19:03, status changed: 2026-05-31 08:20:05

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	HRDSVDSAPILTAFNSSHKGRI
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCHHHCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.7944	4.82574	29.661	110
cluster_2.pdb ( medoid)	19.6546	10.5827	32.4128	208
cluster_3.pdb ( medoid)	18.5619	10.4515	29.5297	194
cluster_4.pdb ( medoid)	12.0957	7.93671	25.8671	96
cluster_5.pdb ( medoid)	11.1601	7.61645	18.9074	85
cluster_6.pdb ( medoid)	7.44033	14.3811	39.0219	107
cluster_7.pdb ( medoid)	6.50208	7.99744	24.1469	52
cluster_8.pdb ( medoid)	5.00938	14.9719	40.7897	75
cluster_9.pdb ( medoid)	3.54108	11.296	29.0894	40
cluster_10.pdb ( medoid)	3.12823	10.5491	28.7398	33