Project name: primed p12

Status: done

submitted: 2025-05-09 14:41:03, status changed: 2025-05-09 19:44:40

Project settings
Protein sequence(s) TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence WWHEWQ
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 55.3913 2.41915 7.85834 134
cluster_2.pdb ( medoid) 48.4639 3.81727 21.8032 185
cluster_3.pdb ( medoid) 29.7516 5.00813 19.6448 149
cluster_4.pdb ( medoid) 27.9203 3.50999 14.7634 98
cluster_5.pdb ( medoid) 25.2564 2.89036 13.3259 73
cluster_6.pdb ( medoid) 19.6336 5.0933 12.3314 100
cluster_7.pdb ( medoid) 19.5171 3.99651 11.5759 78
cluster_8.pdb ( medoid) 14.6929 7.21436 19.4452 106
cluster_9.pdb ( medoid) 5.95478 9.40421 30.7493 56
cluster_10.pdb ( medoid) 1.49657 14.032 39.5556 21