CABS-dock: C-H-190

Project name: C-H-190_4

Status: done

submitted: 2025-02-04 08:27:05, status changed: 2025-02-04 21:31:53

Project settings

Protein sequence(s)

MNMNVLVLCFVLSVSAEGLHVDRQVIGCSDHDGEQAYNLDGEEMWFADFIKREGVEPQPPFIDHITYVDGTYQGAEANQHVCKSNLDVSRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb

Peptide sequence

RTDRIAKYNQLLRIE

Simulation mc cycles

Peptide secondary structure psipred

CCHHHHHHHHHHCCC

Flexible regions

108:B - 18:B

100:A - 19:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	62.3313	1.62037	12.5226	101
cluster_2.pdb ( medoid)	32.206	6.83103	33.3182	220
cluster_3.pdb ( medoid)	23.2098	10.3405	62.1153	240
cluster_4.pdb ( medoid)	14.0581	9.1051	35.3176	128
cluster_5.pdb ( medoid)	10.6339	5.73635	14.5065	61
cluster_6.pdb ( medoid)	10.2533	4.38885	12.9704	45
cluster_7.pdb ( medoid)	5.09363	15.1169	39.9941	77
cluster_8.pdb ( medoid)	4.81777	10.5858	36.3072	51
cluster_9.pdb ( medoid)	3.93883	12.1864	24.1987	48
cluster_10.pdb ( medoid)	2.45504	11.8124	22.1585	29